SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360988 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000360988
Domain Number - Region: 81-186
Classification Level Classification E-value
Superfamily Tropomyosin 0.00216
Family Tropomyosin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360988
Sequence length 213
Comment LUZP4 (Homo_sapiens) leucine zipper protein 4
Sequence
RGNVSFLDMSLDDIILLKNSGDGSTEEKKGKFEDDMKKPGTSGEQSDAHEHPWQRGHAKY
SKERSDNDSESKSGEEDSVSKSGQSPLNQQPLQKQEKCNDDYKAQLEEKEQQSEGNRDNL
ERSHDQPKRFHGQSERSHGPSGRSHGHSEKSHGHSERSHGHSERSHGRPERSHGRSEKSH
GHSERFHGYSGRSHGHSGRSYGQSERSHCQSER
Download sequence
Identical sequences G5BL50
HGL_H00000360988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]