SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360998 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360998
Domain Number 1 Region: 15-160
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-30
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360998
Sequence length 162
Comment ANKRD22 (Homo_sapiens) ankyrin repeat domain 22
Sequence
MLVFQELCLFFSTQPICQAAYQNDFGQVWRWVREDSCYVNIQDGFNGDTPLICACRRGHV
KIVSFLLKRNANVNLKNQVSKTKQNEYLVRMLLDAGVEVNATDCYGCTALHYACKMKNQT
LIPLLLEAHADPMIKDKHGESSLDIAQRLKFSQIELMLRKAS
Download sequence
Identical sequences G5BT01
HGL_H00000360998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]