SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361021-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361021-3
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.9e-29
Family PLC-like (P variant) 0.000000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361021-3
Sequence length 202
Comment PTEN (Homo_sapiens) phosphatase and tensin homolog
Sequence
MMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGSTRREDKLMYFEFPQLLPVCGDIKAEF
FHKEGKMLKKDKMFRFWVNIVFITGPEETSEQVENGSLCDQEIDSICSIEHTDNDKEYLV
LTLTKNDLDKANKDKSNQYDSPNFKVKPYFTKTVEEPSNPEASSSSSVMPDVSDNEPDHY
ILIPLTLTQRMSHLMKIGTHKL
Download sequence
Identical sequences G5C9V8
HGL_H00000361021-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]