SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361162 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361162
Domain Number 1 Region: 34-317
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.39e-57
Family CAF1-like ribonuclease 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361162
Sequence length 511
Comment TOE1 (Homo_sapiens) target of EGR1, member 1 (nuclear)
Sequence
MAAGSEDSAASAPATSDGGVNKSPKSREELVLVQVPVVDVQSDNFKEMWPSLLLAIKTAS
FVAVDTELSGLGDRKSLLNQCIEERYKAVCHAARTRSVLSLGLACFKQQPNKGEHSYLAQ
VFNLTLLCMEEYVIEPKSVQFLVQHGFNFNRQYAQGIPYHKGNDKGDESHSQSVRTLFLE
LIRAQRPLVLHNGLIDLVFLYQNFYAHLPDSLGTFTADLCEMFPAGIYDTKYAAEFHARF
MASYLEYAFKKCERENGKQRATGSPHLTLEFCSYPSSMRTHIDYRCCMPPATHHPHPSSV
CDNFSAYGWCPLGPQCPRSHDIDLIIDTDEAMLEDKRRRRRRKEKRRRALLSMPGTRTSR
EAEDCPPTKQVCGDSLKTEEVEQKVTENETKDPPGSQESHKNDLEMGLQAIGPETADMPT
VEEPGSQASPNQVPGDGLHRAGFDAFMTGYVMAYVGVSQGPQPCSSGLWLPECHNKVYLS
GKAVPLTVAKSQFSRSSKAHNQKMKLAWGSS
Download sequence
Identical sequences G5ARU0
XP_004872983.1.39548 HGL_H00000361162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]