SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361254 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361254
Domain Number 1 Region: 52-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000977
Family Glutathione peroxidase-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361254
Sequence length 229
Comment C10orf58 (Homo_sapiens) Uncharacterized protein C10orf58 Precursor
Sequence
MSFLQDPSFFSMGMWSIGAGALGAAALALVLANTDIFLSKSEEATLEYLENIDLKTLEKD
PRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKPKLDKLGIPLYAVVKEQVGTE
VKDFQPYFKGEIFLDAQKKFYGPQRRKLLFMGFMRLGVWCNFFRAWSGGFSGNLKGEGVI
LGGVFVVGPGKQGILLEHREKEFGDKVNPLSILEAAKKVKPRSLASENK
Download sequence
Identical sequences G5BGY0
XP_004867803.2.39548 XP_004867805.1.39548 XP_012922130.1.39548 HGL_H00000361254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]