SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361405 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361405
Domain Number 1 Region: 506-698
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.66e-56
Family Hemopexin-like domain 0.000000028
Further Details:      
 
Domain Number 2 Region: 109-217,394-447
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.6e-45
Family Matrix metalloproteases, catalytic domain 0.000000518
Further Details:      
 
Domain Number 3 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-21
Family Fibronectin type II module 0.00016
Further Details:      
 
Domain Number 4 Region: 335-389
Classification Level Classification E-value
Superfamily Kringle-like 6e-21
Family Fibronectin type II module 0.00018
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 7.14e-20
Family Fibronectin type II module 0.00021
Further Details:      
 
Domain Number 6 Region: 36-104
Classification Level Classification E-value
Superfamily PGBD-like 9.73e-18
Family MMP N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361405
Sequence length 699
Comment MMP9 (Homo_sapiens) matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Sequence
MSPWQPLVVLLVLGCCSAAPQRPQPTLVIFPRDLRSSNLTDKQLAEEYLFRYGYTRVANM
HQGNKSLRASLLLLQKQLSLPETGELDSATLEAIRTPRCGVPDVGKFQTFEGDLRWHHRN
ITYWIQNYSEDLPRALIDDAFARAFAVWSAVTPLTFTRVYGRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWTLGKGVVVPTYFGNADGAPCHFPFPFAGRS
YSACTTDGRTDDKPWCSTTADYDTDRQYGFCPSERLYTQHGNGDGQPCVFPFTFEGRSYS
ACTTEGRSDGYRWCATTANFDQDKLYGFCPTRADATVIGGNAAGELCVFPFVFLGKEYSS
CTGEGRRDGRLWCATTSNFDTDRKWGFCADQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFLEGSPLHEDDVKGIQHLYGPGPEPEPRPPVTTTREPQPTAPSTVCPTLPPTAHPT
AGPTGPPAAGPTGPPTAGPPPDPVDNPCNVNIFDAIAEIGNYLHFFKDGRYWRFSEGRRR
QLQGPFLIADTWPALPARLDSAFEEPLSKKIFFFSGRQVWMYTGASVLGPRRLDKLGLGS
EVTQVTGVISRGGGKALLFSRERFWRFDVKTQRVDSRSVTPVDHMFPGVPLDMHNIFQYR
EKAYFCQDRFYWRVSFRNEMNQVDEVGYVTYDILQCPEN
Download sequence
Identical sequences G5B7Q1
HGL_H00000361405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]