SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361423 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361423
Domain Number 1 Region: 231-498
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-84
Family Protein kinases, catalytic subunit 0.00000000012
Further Details:      
 
Domain Number 2 Region: 122-262
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-37
Family SH2 domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 62-147
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-20
Family SH3-domain 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361423
Sequence length 1094
Comment ABL1 (Homo_sapiens) c-abl oncogene 1, non-receptor tyrosine kinase
Sequence
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEHQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRDCNRQEVTAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAASTLLQAPELPTKTRTCRRAAE
HRDAPDVSEMPPTKAQGESEPLDHEPAASPLLPRKERAAPDGGLNEDERLLPKDKKTNLF
SALIKKKKKMAPTPPKRSSSFREMDGQPERRGPAEEDGREASNGPATLLSLPSRQNPATQ
LARLAASGEEGGGSASKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGG
HKSEKPALPRKRASENRPDQAARGTGTPPPRLVKKAEETADEVFKDATESSPGSSPPSLT
PKLLRRQVVMAPPTGLTHKEEAGRGSASGTPAAAEPGPPVSRAGTGTPGGPSKAPAEEPR
VRRHRHVSESPGRDRGRLSKLKPVPPPLPASAGKAGKASQSPGQEAAGEAGTKAKALGLA
VDAVSSDAAKPSQLVEGLKKSVLPSGPKLQSATKAPGTPISPVPAPSVLPAASSGLAGDQ
PSSTAFVPLISTRVSLRKPRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMVSHSAV
LEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGGGPAATQDFSK
LLSSVKEISDIVQR
Download sequence
Identical sequences G5AT60
HGL_H00000361423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]