SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361433 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361433
Domain Number 1 Region: 168-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.54e-40
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000295
Further Details:      
 
Domain Number 2 Region: 74-166
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.95e-26
Family Cold shock DNA-binding domain-like 0.00000578
Further Details:      
 
Domain Number 3 Region: 25-74
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000549
Family ECR1 N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361433
Sequence length 293
Comment EXOSC2 (Homo_sapiens) exosome component 2
Sequence
MAMEMRLPVARKPLSETLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
ERVNKLICVKALKTRYNGEVGDIVVGRITEVQQKRWKVDTNSRLDSVLLLSSMNLPGGEL
RRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVK
RQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEDAGGFIANLEPVSLADREVMSRLRNC
VVSLVTQRMMLYDTSILYCYEASLPHQIKDILKPEVMEEIVLETRQRLLEQEG
Download sequence
Identical sequences G5AT62
HGL_H00000361433 XP_004849162.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]