SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361467 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361467
Domain Number 1 Region: 1203-1313
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-34
Family PDZ domain 0.00000473
Further Details:      
 
Domain Number 2 Region: 1863-2040
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.66e-29
Family Nucleotide and nucleoside kinases 0.00016
Further Details:      
 
Domain Number 3 Region: 1389-1481
Classification Level Classification E-value
Superfamily PDZ domain-like 7.32e-17
Family PDZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 508-620
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-16
Family PDZ domain 0.0022
Further Details:      
 
Domain Number 5 Region: 632-704
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-16
Family PDZ domain 0.028
Further Details:      
 
Domain Number 6 Region: 1490-1558
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000722
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 7 Region: 1706-1774
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000722
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361467
Sequence length 2043
Comment DLG5 (Homo_sapiens) discs, large homolog 5 (Drosophila)
Sequence
MTLLLGMDATSGSTYSVLSVMPSDSESSSSLSSVGTTGKASSPLPLPADQQVNEKVENLS
IQLQLMTRERNELRKRLAFATHGATFDKRPYRRLNPDYERLKIQCVRAMSDLQSLQNQHT
NALKRCEEVAKETDFYHTLHSRLLSDQTQLKDDVDMLRRENGQLLRERNLLQQSWEDMKR
LHEEDQKEIGDLRAQQQQVLKHNGSSEILNKLYDTAMDKLEVVKKDYDALRKRYSEKVAM
HNSDLSRLEQLTEENQRLLKQTEMLTQQRDTAIQLQHQCALSLRRFEAIHYELNKATAQN
KDLQWEMELLQSELTELRTMQVRTAQESEKYREERDAVFSEYRLIMSERDQVISELDKLQ
TEVELAESKLKNSTSEKKAANEEMETLRQIKDTMTVDAGRANKEVEILRKQCKALCQELK
EALQETDVAKCRRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAEALRSLDDTRK
QKNDVSRELKELKEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDI
DLKALGFDMAEGVNEPCFPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQ
AIRALLNGEGAINMVVRRRKSLGGKVVTPLHINLSGHKDSGISLETGVYAAAVAPGSPAA
KEGTLAVGDRIVAINGIALDNKSLNECESLLRSCQDSLTLSLLKVFPQSASWSGQNIFEN
IKDSDKLVSFRTHGPEVQAHNKRNLMQHNNSTQTDIFYEDHPEDRRELGPPRGSSSFLHK
PFLGDPFPAPPQTCPSTSERSLSSFRSDNSGERGYGLVDVRSRQPLPSFETEGAPCGAVE
APLDKADSEGSNSGGTWPKAVPGSVAGPEKLSPSKRVGPLTPPKPPKRSDSIKFQHRLET
SSESEATLVGSSPSTSPPIALPPRLDPGEPMHASPPRKARVRIASSYYPEGDGDTSCLPA
KKSCDEDLTSQKVDELGQKRRRPKSAPSCRPKVAPVVIPAQFLEEHKCVPASGELSPEAQ
EWSPHSPGHSSRQGNSPFYPNRPSVGTVPRNVTPSTTVSSILRNPIYTVRSHRVGPCSSP
PVPRDVGPQNLPPSVQHQGRLSLDLSHRACGDCSDMRASHGSNSLPSSARLGSSSNLQFK
AERIKIPLTPRYPRSVMGSDRGSLSHSECSTPPQSPLNIDTLPSCSQPQTSASTLPRIAI
NATSHGERRKDRPYLEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTPGSIAHQAGLEY
GDQLLEFNGINLRSATEQQARLIIGQQCDTITILTQYNPHMHQLSSHSRSSSHLDPAGAH
STNQGSGATTPEHPSVIDPLMEQDEGPGSPPAKQSTPSSRQSQVITQLGPELWPPVAVLS
RGRTVGDTNKKTSEPRVVFIKKSQVELGVHLCGGNLHGVFVAEVEDDSLAKGPDGLMPGD
LILEYGNLDMRNKTVEEVYVEMLKPKDVIRLKVQHRPEDFARIKGLPGDGFYIRALYDRQ
GEVEHDLNFKKDDILYVDNTLPQGTFGCWMAWQLDESAHKMQRGQIPSKYVMDQEFSRRL
SMSEVKDDGNTAKTLSAAARRSFFRRKHRHKRSGSKDGKDLLALDTFSNDPIPLLEGKCQ
ATSLWALWEGSLKLHNWGPNKRKDYSAVVHQTGGGCPGCRYGNLDMRNKTVEEVYVEMLK
PKDVIRLKVQHRPEDFARIKGLPGDGFYIRALYDRQGEVEHDLNFKKDDILYVDNTLPQG
TFGCWMAWQLDESAHKMQRGQIPSKYVMDQEFSRRLSMSEVKDDGNTAKTLSAAARRSFF
RRKHRHKRSGSKDGKDLLALDTFSNDPIPLLEGKCQATSLWALWEDSMSLAYQRVQKADC
TSLRPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSG
HFDVTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKQIKEQRDPVY
LRDKVTQRHSKEQFETAQKIEQEYSKYFTAVVQGGPLSSICTQILAVVNQEQSKALWIPA
GPI
Download sequence
Identical sequences G5BRJ8
HGL_H00000361467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]