SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361527 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000361527
Domain Number - Region: 34-158
Classification Level Classification E-value
Superfamily Tropomyosin 0.000497
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361527
Sequence length 559
Comment TJAP1 (Homo_sapiens) tight junction associated protein 1 (peripheral)
Sequence
MTSAAPAKKPYRKAPPEHRELRLEGPGSRLEQEEPLTDAERMKLLQQENEELRRRLASAT
RRTEALERELEIGQDCLELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLA
SLSHSWIFAIQKAEMDRKTLDWEIVELTNKLLDARNTINRLEELNERYRLDCNLAVQLLK
CNKSHFRSHKFADLPCELQDMVRKHLHSSPEAAILGPAPRPAPGAVVPTSIIARVLEKPE
SLLLNSAQSGSAGQPLAEDVFVHVDMSGGAPGDTASPPAPSSPIPQPNGECHSLGTTGAS
PEEEQSLPAFEKLSPYPTPSLPHPLYPGRKVIEFSEDKVRIPQNSPLPNCTYATRQAISL
SLVEESSEWAHPSPEPSRPASTQASPYHQPGPTASASNNLASSTSSEEDLLASWQRAFVD
RTPPPTAVVQRTAFGRDALPELQCHFALSPVNQDEVILTPSAPPSESGVLLPMEPRPGSA
REEEEEMFNLPVSPEEERQSLLAGDRGAEEGPGASHTEGRAWPLPGSSRPQRSPKRMGVH
HLHRKDSLTQAQEQGTLLS
Download sequence
Identical sequences G5BNM5
HGL_H00000361527 XP_012928432.1.39548 XP_012928433.1.39548 XP_012928434.1.39548 XP_012928435.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]