SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361768-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361768-1
Domain Number 1 Region: 156-280
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.53e-22
Family Synaptotagmin-like (S variant) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361768-1
Sequence length 308
Comment RIMS3 (Homo_sapiens) regulating synaptic membrane exocytosis 3
Sequence
MFNGEPSPASAGASRNVVRSSSISGEICGSQQTGGGTGTTTAKKRRSSLGAKMVAIVGLT
QWSKSTLQLPQPEGATKKLRSNIRRSTETGIAVEMRSRVTRQGSRESTDGSTNSNSSDGT
FIFPTTRLGAESQFSDFLDGLGPAQIVGRQTLATPPMGDVHIAIMDRGGQLEVEVIEARG
LTPKPGSKSLPATYIKAYLLENGCCLAKKKTKVAKKTCDPLYQQALLFEEGPQGKVLQVI
VWGDYGRMDHKCFMGMAQIMLDELDLSAVVTGWYKLFPTSSVADSTLGSLTRRLSQSSLE
SATSPSCS
Download sequence
Identical sequences G5AQK2
XP_004871840.1.39548 XP_012923647.1.39548 HGL_H00000361768-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]