SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361784 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361784
Domain Number 1 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 303-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-21
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 131-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-16
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 5 Region: 2-40
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000115
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 
Domain Number 6 Region: 220-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000242
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361784
Sequence length 357
Comment ZNF684 (Homo_sapiens) zinc finger protein 684
Sequence
MLDCDQRMMYWDVMLDNYRNLISVGSPVTKPKVILKVEQGQDPWLAEEENLHGSYPEADC
LLDEPEKHQESKDNFLKSVLFTFSRILTMEKLHHYNRSTNLNPTRKRSHKCKSYGKNLEP
NLDLLNYNRSYTGENSYECNECGKAFKKKFHFIRHEKNHTRKKPLECSICGKAYSRKAYL
IAHQKMHSGERPFVCTDCGKAFTQKSYLVNHQRLHTGEKPYKCSRCGKTFIWSSSFNQHV
KSHMPANPFECKECGKTFKYSSSLYKHSRSHTGEKPYRCVVCGKAFGNTSVLVTHQRIHT
GEKPYGCIECGKAFIKKSHLLRHQVTHTGEKPYECNICGKAFSQKSNLIVHQKMHTL
Download sequence
Identical sequences G5AQK3
HGL_H00000361784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]