SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361791 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361791
Domain Number 1 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 69-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.09e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.79e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 5 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 351-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000358
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Weak hits

Sequence:  HGL_H00000361791
Domain Number - Region: 233-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000201
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0371
Family SCAN domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361791
Sequence length 523
Comment ZNF642 (Homo_sapiens) zinc finger protein 642
Sequence
MPQQLLMTLSSEASTWVKLHHPRNAMEGMPLWEDVTKMFEGEALLSQDTDETQGESFEDE
VIPGILTTESQKLLNFKDISVDFNQEEWGQLAPAHRNLYREVMLENYRNLVSVGYHFSKP
SVISQLEKGEEPWMTEKEDLGDPSTDLKSKTETSRSSSKNGISQEQLYHGIMMERFISND
VIYSTLRKVSRYDDALEGHQEAYRADVRQTILAHKKTGREAKKFGENIVSSNIILEQKHY
KCDNSRKRNKYKLDLINHPMSCIRTKIYECNICEKMFKQPIHLTEHTRIHTGEKPFRCKE
CGRAFSQSASLNTHQRIHTGEKPFECEECGKTFRHRSSLNQHHRTHTGEKPYVCDKCQKA
FSQNISLIQHLRTHSGEKPFTCSECGKTFRQIRHLSEHVRIHTGEKPYACTACCKTFSHR
AYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDSSFK
KHQRHHTGEKPYECNECGKSFSYNSSLSRHHEIHRRNASPNNV
Download sequence
Identical sequences G5CBJ3
XP_004851111.1.39548 XP_004851112.1.39548 HGL_H00000361791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]