SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361850 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361850
Domain Number 1 Region: 166-374
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.93e-51
Family Eukaryotic proteases 0.0000000388
Further Details:      
 
Domain Number 2 Region: 410-561
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.13e-42
Family Eukaryotic proteases 0.0000021
Further Details:      
 
Domain Number 3 Region: 50-156
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-31
Family Kringle modules 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361850
Sequence length 570
Comment PLAU (Homo_sapiens) plasminogen activator, urokinase
Sequence
MSILLAFLFLCAVVLSDSQGRQEVGATDAEKCGCLNGGSCVTYKYFSGIRRCNCPKRFQG
EHCEIDAWKTCYEGNGHSYRGKANTDSKGRPCLGWNSAAVLQQKFHAYRSDAVHLGLGKH
NYCRNPDNRRRPWCYVQIGLKQFVQECMVHDCALGRKPSSPKQEEFQCGQKAVKPRFKII
GGEFTTIENQPWFAAIYRKNRGDSASYMCGGSLISPCWVVSATHCFIENPEKEDYIVYLG
RSKLNSDTPEEVKFEVEQLILHENYSAEKLAHHNDIALLKIRSSSGQCAQPSRSIQTICL
PPKNNGAPFGASCEITGFGKENFADYLYPEHLKMTVVKLVSYKECQQPHYYGSEVTTDML
CAADPQWETDSCQVRVPGNSLSPPHLPEACGPDSARIKEPLSSQSLKKPALLKIRSSSGQ
CAQPSRSIQTICLPPKNNGAPFGASCEITGFGKENFADYLYPEHLKMTVVKLVSYKECQQ
PHYYGSEVTTDMLCAADPQWETDSCQGDSGGPLVCSIQDPQTGNYHLTLTGIVSWGRGCA
LKDKPGVYTRVSRFLPWIHFHTREDNGLGL
Download sequence
Identical sequences G5C7I1
HGL_H00000361850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]