SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361882-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361882-1
Domain Number 1 Region: 584-694
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000706
Family Myosin rod fragments 0.0041
Further Details:      
 
Weak hits

Sequence:  HGL_H00000361882-1
Domain Number - Region: 110-272
Classification Level Classification E-value
Superfamily Tropomyosin 0.000916
Family Tropomyosin 0.007
Further Details:      
 
Domain Number - Region: 714-784
Classification Level Classification E-value
Superfamily Tropomyosin 0.0582
Family Tropomyosin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361882-1
Sequence length 819
Comment ODF2 (Homo_sapiens) outer dense fiber of sperm tails 2
Sequence
RFPSCGKNRITSLTQKNILRTPCGPPSVTVTKSHKRGMKGDTVNVRRNVRVKTKVPWIPP
GKSSARHVGCKWETPPHCLEVTPPSSEKLVSVMRLSDLSTEDDDSGHCKMSHYDKKIDSL
MNAVGCLKSEVRMQKGERQMAKKFLEERKEELEEVAHELAETEQENTVLRHNIERIKEEK
DYTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTEKQMTCTDINTLT
RQKELLLQKLGTFEETNRTLRDLLREQHCREDSERLMEHQGALLKRLAEADSEKARLLSL
LQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCREAENSRLCMQIKNL
ERIGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK
DLYVAEALSTLESWRSRYNQVVKDKGDLELEIIVLNDRVADLVNQQQTLEEKMREDRDSL
VERLHRQTAEYSAFKLENERLKASFTPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQV
MKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKL
AECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELE
RKLEATSAQNVEFLQVIAKREEAIHLSQLRLEEKTRECGSLARQLESALEDARRQVEQTK
EQALSKERVAQNKILDLETQLSRTKTELSQLRRSREDADRRYQSRLQDLKDRLEQSESTN
RSMQNYVQFLKSSYANVFGDSPYTSFLTSSPVRSRSPPA
Download sequence
Identical sequences G5ASE6
HGL_H00000361882-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]