SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361927 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361927
Domain Number 1 Region: 276-365
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-23
Family Canonical RBD 0.0000046
Further Details:      
 
Domain Number 2 Region: 105-198
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.81e-21
Family Canonical RBD 0.00000636
Further Details:      
 
Domain Number 3 Region: 5-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-19
Family Canonical RBD 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361927
Sequence length 416
Comment HNRNPH2 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein H2 (H')
Sequence
MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTAGIRFIYTREGRPSGEAFVE
LESEDEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPF
GCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRH
VEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGY
GGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMTDHRYGDGGSSFQSTTGHCVHMRGLPYRA
TENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELF
LNSTAGTSGGGYDHSYVELFLNSTAGASGSAYGSQMMGRMGLSNQSSYMGVLLASS
Download sequence
Identical sequences G5C2S9
HGL_H00000361927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]