SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361942-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361942-1
Domain Number 1 Region: 12-132
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.34e-23
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361942-1
Sequence length 135
Comment RIMS4 (Homo_sapiens) regulating synaptic membrane exocytosis 4
Sequence
MGEIKIALKKEMKTEGEQLVVEILQCRNITYKFKSPDHLPDLYVKIYVMNISTQKKVIKK
KTRVCRHDREPSFNETFRFSLSPAGHSLQILLFSNGGKFMKKTLIGEACIWLDKVDLRKR
IVSWHKLLASPTQAH
Download sequence
Identical sequences G5B0R3
HGL_H00000361942-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]