SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361949-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361949-1
Domain Number 1 Region: 11-122
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.5e-23
Family Canonical RBD 0.00013
Further Details:      
 
Domain Number 2 Region: 150-188
Classification Level Classification E-value
Superfamily PABC (PABP) domain 0.0000000000196
Family PABC (PABP) domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361949-1
Sequence length 205
Comment PABPC4 (Homo_sapiens) poly(A) binding protein, cytoplasmic 4 (inducible form)
Sequence
MNAAVRSYPVASLSVGDLHSDAAEAVLYEKFSRAGPVLPIRVCGDVITRRSLGHAYVSFQ
QPAEAERALDTMNFDGIKGKQIYIMWPQKDPSLTKSGVGNVFIKNLDKSIDNKALYDTFS
ALEQSRCSENVCSPSSKQGIRAWLASSQALEMDNSELLHTLESPKSLHSKVDEAVAVLQA
HHAKKEAARRWALLLLLPLRQGKHD
Download sequence
Identical sequences G5AYM6
HGL_H00000361949-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]