SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361949-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361949-2
Domain Number 1 Region: 190-374
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.51e-53
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 2 Region: 10-179
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.55e-50
Family Canonical RBD 0.0000252
Further Details:      
 
Domain Number 3 Region: 533-657
Classification Level Classification E-value
Superfamily PABC (PABP) domain 4.06e-46
Family PABC (PABP) domain 0.00000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361949-2
Sequence length 661
Comment PABPC4 (Homo_sapiens) poly(A) binding protein, cytoplasmic 4 (inducible form)
Sequence
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPSGKSKGFGFVSYEK
HEDANKAVEEMNGKEISGKVIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKN
LDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGS
KPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRP
PYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTT
TQRVGSECPDRLAMDFGGAGAAQQGLTDSCQSGGGVPTAVPNLAPRAAVAAAAPRAVAPY
KYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMH
SNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAAT
S
Download sequence
Identical sequences G5C4Y5
HGL_H00000361949-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]