SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361952 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361952
Domain Number 1 Region: 155-244
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-19
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 2 Region: 94-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-17
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361952
Sequence length 327
Comment KCNK15 (Homo_sapiens) potassium channel, subfamily K, member 15
Sequence
MGPPSVPWMTSSPWADSQCLLPGHTVQTEEGSVSSMIVDVSLLNLSAAQSSPLGPHVLGN
ASLVRLDSVSLRPWQEEWAGLFRSSKLHCHMAVKWKFAGSFYFAITVITTIGYGHAAPGT
DSGRVFCMFYALLGIPLTLVTFQSLGERPRVSTENMVVAGLLVCVATLALGAATFAHFEG
WTFFHAYYYCFITLTTIGFGDFVALQSDEALQRKPPYVAFSFLYILLGLSVIGGFLNLVV
LRFLAASSDTPESAARRVSPFRRGAPKSRGLDRPRRVAGVRADTWVAHRILQLQMPACDN
PGFSPPWSPTAVRGGRADRPRARRKSV
Download sequence
Identical sequences G5BB32
HGL_H00000361952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]