SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000362080 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000362080
Domain Number 1 Region: 353-487
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.99e-35
Family Synaptotagmin-like (S variant) 0.001
Further Details:      
 
Domain Number 2 Region: 498-639
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.7e-33
Family Synaptotagmin-like (S variant) 0.0022
Further Details:      
 
Domain Number 3 Region: 8-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.16e-26
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000362080
Sequence length 676
Comment SYTL4 (Homo_sapiens) synaptotagmin-like 4
Sequence
MSEILDLSFLSEMERALIINVLQRDEELRQADEKRIRRLKSELLEIKRKGAKRGSQHYSD
RTCARCQENLGRLTPKTNICRGCNHFVCRDCRIQESNGTWRCKVCTKEIELKKATGDWFY
DQKVNRFAYRTGSEIIRMSLRRKPTVNKRETVGQSLLHQTQMGDIWPGRKIIREQQKEHS
VPFEVPKLKSGKSALEAESESLDSYTADSDSTSRGDSLDKSGLFPEWKKMSAPRSQVEKE
MQPVGQNVVSVDEDEIIFKNTRKVFRPSEYTKSVIDLRPEDVGPESSSMGDRSKSVPGLS
VNMEEEKEEEEEEEEEDIDHLVKLHRQKLARNSMQSGSSMSTIGSIMSIYSEAGDFGNIF
VTGKIAFSLNFEQQTQTLVIHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSI
KRDTVNPLYDEILRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEVHMDSWKLDKKLD
HCLPLHGKISAESPTGLPSHKGELVVSLKYIPSPKLPVGGNWKKSKGMEGGELQVWIKEA
KNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYSGMRLEDLQHM
CLELTVWDREPLTSNDFLGGVRLGVGSGISNGELVDWMDSTGEEVSLWQKMRQYPGSWAE
GTLQLRSSMAKQKLGL
Download sequence
Identical sequences G5B2L2
HGL_H00000362080 XP_004872644.1.39548 XP_012923889.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]