SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000362352 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000362352
Domain Number 1 Region: 179-368
Classification Level Classification E-value
Superfamily Macro domain-like 1.59e-46
Family Macro domain 0.000000233
Further Details:      
 
Domain Number 2 Region: 13-117
Classification Level Classification E-value
Superfamily Histone-fold 6.46e-38
Family Nucleosome core histones 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000362352
Sequence length 372
Comment H2AFY2 (Homo_sapiens) H2A histone family, member Y2
Sequence
MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEI
LELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGT
KGKSETILSPPPEKRGRKATSGKKGGKKTKAAKPRASKKSKAKDSDKEGTSNSTSEDGPG
DGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKE
FLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSA
AEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIG
IYVQEMAKLDIK
Download sequence
Identical sequences G5B190
HGL_H00000362352 XP_004846249.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]