SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000362463 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000362463
Domain Number 1 Region: 19-178
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.75e-37
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000362463
Sequence length 184
Comment GLO1 (Homo_sapiens) glyoxalase I
Sequence
MAEPQPASGGLTDEVALSCCSDSDPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLLQK
LDFPTMKFSLYFLAYEDKNDIPKDKNEKVAWVFSRKATLELTHNWGTEDDDTQSYHNGNS
DPRGFGHIGIAVPDVHSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKI
ATLT
Download sequence
Identical sequences G5B9F4
XP_004846705.1.39548 HGL_H00000362463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]