SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000362687 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000362687
Domain Number 1 Region: 211-505
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-67
Family Tandem AAA-ATPase domain 0.00026
Further Details:      
 
Domain Number 2 Region: 575-655
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.79e-23
Family GUCT domain 0.00000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000362687
Sequence length 737
Comment DDX50 (Homo_sapiens) DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
Sequence
MPGKLLWGDIMELEAPLEESESQRKEQQKSDRRKSRHCHDSDEKTESRENGVTGDLDAPK
PKKSKIKEKLNGDTEEGFNRLSDEFSTSPKLRKKDLPNGDIDECEKKSKQVSSLESSTQK
SSDNKLQETLTREQKEGAFSNFSISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQ
ARTGTGKTFSFAIPLIERLQRNQEAIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSV
ACFYGGTSYQSQINHIRNGIDILIGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGF
AEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAAT
TVEHLAIQCHWSQRPAVIGDVLQVYSGSEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHG
DIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGRTG
RAGRTGICICFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSMDAIRSLASVSYA
AVDFFRPSAQRLIEEKGAVDALAAALAHISGASSFEPRSLITCDKGFVTMTLESPEEIQD
VSCAWKELNRKLSSNAASQITRMCLLKGKMGVCFDVPTTESERLQAEWHDSDWILSVPAK
LPEIEEYYDGNTSANSRQRSGWSSGRSGRSGRSGGRSGGRSGRQSRQGSRSGSRQDGRRR
SGNRNRSRSGGHKWSFD
Download sequence
Identical sequences G5B802
XP_004846230.1.39548 HGL_H00000362687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]