SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000362711 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000362711
Domain Number - Region: 333-490
Classification Level Classification E-value
Superfamily Tropomyosin 0.000451
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000362711
Sequence length 553
Comment TXLNA (Homo_sapiens) taxilin alpha
Sequence
MKNQDKKNGAAKQSNPKNSLGQPETGTEGVHGRPSQSPPTEAEGSASQAPGRTEGAQAKT
SQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPTEPEDAEKSRTYAARNGE
PEPGTPAVNGEKETSKGEPGTEEIRASDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLNT
LSTPEEKLAALCKKYAELLEEHRTSQKQMKLLQKKQSQLVQEKDHLRGEHSKAILARSKL
ESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQVTLNDIQLQMEQHNERNSKLRQE
NMELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQAQEMLKEAEERHQREKDF
LLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFTTFKQEMEKMTKK
IKKLEKETTMYRSRWESSNKALLEMAEEKTLRDKELEGLQVKIQRLEKLCRALQTERNDL
NKRVQDLSAGGQGSLTDSGPERRPEAATVAKEQGGEGPGTQAPSSSRATEAPGCPGTPST
EATGPQEPTSATA
Download sequence
Identical sequences G5BU95
HGL_H00000362711 XP_004850894.1.39548 XP_004850895.1.39548 XP_004850896.1.39548 XP_012929802.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]