SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000362820-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000362820-2
Domain Number 1 Region: 9-112
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-24
Family Canonical RBD 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000362820-2
Sequence length 164
Comment SRSF3 (Homo_sapiens) serine/arginine-rich splicing factor 3
Sequence
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
Download sequence
Identical sequences A0A087QMW5 A0A087V986 A0A091EW78 A0A091GSK1 A0A091ID09 A0A091KDL6 A0A091M2C5 A0A091QLN8 A0A091T583 A0A091TD87 A0A091V6I9 A0A091WS87 A0A093BR54 A0A093ENQ6 A0A093GPN2 A0A093H3H3 A0A093JML7 A0A093KZK7 A0A093NLD6 A0A093R1G3 A0A093RUZ5 A0A094KR85 A0A094LT37 A0A096NHS7 A0A0A0AYM9 A0A0P6DDN4 A0A0Q3LXK8 A0A1A6HZB4 A0A1S3AFT0 A0A1S3G8C6 A0A1U7QS82 A0A1U7RWX4 A0A1U7T2W0 A0A212D4U6 A0A218UKS8 A0A250YAR2 A0A286XIK7 A0A2I0M027 A0A2I3HJC3 A0A2I3RXN3 A0A2J8Y3L3 A0A2K5ECL5 A0A2K5JSS1 A0A2K5LS47 A0A2K5RK54 A0A2K6A1R7 A0A2K6D1V0 A0A2K6GMU6 A0A2K6LR14 A0A2K6RP16 A0A2K6STL6 B0FZL9 B2R6F3 B5FY84 E1C8Y9 F1RY92 F2Z4N6 F7AVB5 F7BSI5 F7CM23 F7I7N6 G1QBB5 G1SRH7 G3RLW0 G3TKA5 G3WBA5 G5B542 H0WGJ8 I3N1N9 K7F3G8 K9IH23 L5KYV3 P84103 P84104 Q0ZFS8 Q25NH6 Q3SZR8 U3JKR3
ENSPSIP00000002578 ENSPVAP00000013783 ENSTTRP00000012755 ENSCAFP00000002023 ENSP00000362820 ENSFALP00000003367 ENSSHAP00000012710 ENSRNOP00000000627 ENSSTOP00000012788 ENSRNOP00000000627 ENSECAP00000016378 10090.ENSMUSP00000117045 10116.ENSRNOP00000000627 10141.ENSCPOP00000003361 13616.ENSMODP00000016940 59729.ENSTGUP00000000952 9031.ENSGALP00000000734 9544.ENSMMUP00000018787 9598.ENSPTRP00000030931 9600.ENSPPYP00000018510 9606.ENSP00000362820 9685.ENSFCAP00000001007 9796.ENSECAP00000016378 9913.ENSBTAP00000049550 9986.ENSOCUP00000005776 ENSCAFP00000002023 ENSOARP00000014561 ENSMICP00000004255 ENSSTOP00000012788 ENSCPOP00000003361 ENSPANP00000012525 ENSMUSP00000117045 ENSPSIP00000002578 ENSNLEP00000013039 ENSLAFP00000015242 ENSDORP00000011548 gi|4506901|ref|NP_003008.1| ENSFCAP00000001007 ENSOPRP00000005509 ENSDORP00000011548 ENSBTAP00000049550 ENSCPOP00000003361 ENSETEP00000008214 ENSSHAP00000012710 ENSMUSP00000117045 ENSOPRP00000005509 ENSTGUP00000000952 ENSGALP00000000734 ENSGALP00000000734 ENSPVAP00000013783 ENSGGOP00000016772 ENSMMUP00000018787 ENSPTRP00000050212 ENSP00000362820 ENSP00000482833 ENSTGUP00000000952 ENSETEP00000008214 ENSMODP00000016940 ENSGGOP00000016772 ENSMUSP00000049025 ENSOGAP00000000452 ENSOCUP00000005776 ENSPTRP00000050212 hsk003000105.1 ENSMMUP00000018787 ENSOCUP00000005776 ENSOCUP00000026365 ENSMICP00000004255 NP_001029872.1.59421 NP_001029872.1.76553 NP_001041372.1.100692 NP_001041372.1.4139 NP_001182245.1.54773 NP_001182245.1.66739 NP_001182483.1.86415 NP_001182496.1.23681 NP_001232578.1.42559 NP_001270294.1.63531 NP_003008.1.87134 NP_003008.1.92137 NP_038691.1.92730 XP_001173216.1.37143 XP_001370000.1.35504 XP_001499880.1.31192 XP_002914334.1.58354 XP_003212920.1.16129 XP_003276947.1.23891 XP_003403989.1.64505 XP_003473932.1.53824 XP_003769052.1.9362 XP_003789196.1.62490 XP_003818951.1.60992 XP_003923252.1.74449 XP_003986117.1.62641 XP_004043955.1.27298 XP_004090901.1.23891 XP_004267714.1.21590 XP_004311510.1.83887 XP_004379466.1.4749 XP_004409846.1.74151 XP_004424261.1.5094 XP_004590381.1.84141 XP_004613048.1.94378 XP_004649599.1.11716 XP_004673483.1.23501 XP_004740105.1.14098 XP_004846737.1.39548 XP_005024012.1.99704 XP_005084966.1.91757 XP_005239683.1.75256 XP_005280554.1.60341 XP_005318813.1.77405 XP_005360394.1.66349 XP_005389706.1.28644 XP_005428169.1.5688 XP_005447076.1.10750 XP_005496366.1.73095 XP_005510415.1.63277 XP_005530211.1.90289 XP_005602830.1.31192 XP_005696329.1.57651 XP_005881786.1.60319 XP_005964325.1.78601 XP_006025330.1.24877 XP_006050467.1.26621 XP_006107006.1.53796 XP_006125355.1.96668 XP_006148697.1.99106 XP_006195360.1.101512 XP_006202126.1.17985 XP_006266260.1.47583 XP_006736325.1.47382 XP_006759092.1.95426 XP_006860475.1.41390 XP_006907382.1.64745 XP_006983155.1.50099 XP_007063537.1.26238 XP_007085317.1.5354 XP_007105428.1.24612 XP_007182645.1.59432 XP_007198021.1.59432 XP_007467334.1.90284 XP_007534301.1.11023 XP_007616821.1.28591 XP_007937592.1.48129 XP_007970972.1.81039 XP_008048201.1.4292 XP_008150186.1.99482 XP_008261064.1.1745 XP_008497689.1.100939 XP_008510871.1.77740 XP_008538574.1.77740 XP_008590065.1.73410 XP_008590067.1.73410 XP_008635768.1.15636 XP_008691603.1.72690 XP_008838295.1.79516 XP_008920582.1.96775 XP_008936309.1.37566 XP_008992590.1.60252 XP_009095551.1.15306 XP_009240041.1.23681 XP_009288871.1.47732 XP_009333017.1.49731 XP_009469835.1.38621 XP_009490049.1.14425 XP_009510391.1.22320 XP_009578553.1.87690 XP_009642870.1.23211 XP_009670850.1.43253 XP_009699645.1.71050 XP_009820429.1.37116 XP_009890018.1.48241 XP_009900935.1.92783 XP_009917514.1.2804 XP_009931379.1.35112 XP_009956982.1.99599 XP_009963817.1.75343 XP_009982446.1.11325 XP_009999690.1.85724 XP_010020683.1.70042 XP_010078262.1.40768 XP_010127427.1.88979 XP_010142922.1.100080 XP_010147200.1.22856 XP_010169829.1.30499 XP_010191075.1.17318 XP_010207805.1.23224 XP_010209257.1.20684 XP_010286372.1.48707 XP_010297243.1.13389 XP_010387995.1.97406 XP_010402756.1.2935 XP_010582913.1.12557 XP_010582915.1.12557 XP_010637127.1.5607 XP_010846968.1.44457 XP_010947300.1.22495 XP_010992777.1.51371 XP_011352835.1.92234 XP_011590431.1.59079 XP_011590432.1.59079 XP_011727579.1.29376 XP_011800731.1.43180 XP_011800732.1.43180 XP_011841985.1.47321 XP_011841986.1.47321 XP_011930165.1.92194 XP_011944819.1.92194 XP_011955800.1.66739 XP_012316989.1.9421 XP_012502069.1.63892 XP_012602266.1.48125 XP_012783952.1.84141 XP_012783953.1.84141 XP_012885071.1.60039 XP_012979813.1.91757 XP_012986444.1.78019 XP_013055827.1.65836 XP_013798051.1.3284 XP_014686418.1.49734 XP_014728293.1.99236 XP_014804025.1.91963 XP_014925293.1.86478 XP_014991738.1.72884 XP_015343140.1.40921 XP_015506138.1.82291 XP_015740411.1.68032 XP_016008117.1.101085 XP_016079236.1.3490 XP_016159694.1.66865 XP_017378083.1.71028 XP_017499018.1.32401 XP_017725594.1.44346 XP_017935251.1.51550 XP_018881631.1.27298 XP_019282587.1.44245 XP_019312488.1.44245 XP_019369456.1.87953 XP_019401777.1.79039 XP_019523031.1.44202 XP_019594373.1.88060 XP_019841338.1.53367 XP_020035159.1.5219 XP_020731470.1.74333 XP_020749517.1.74333 XP_020855105.1.61212 XP_020954304.1.46622 XP_020954305.1.46622 XP_021076903.1.100879 XP_021232624.1.32913 XP_021390952.1.53032 XP_021489139.1.76796 XP_021540364.1.83697 XP_532124.3.84170 ENSOGAP00000000452 ENSMLUP00000020998 ENSECAP00000016378 ENSMODP00000016940 ENSCJAP00000029566 HGL_H00000362820-2 ENSBTAP00000049550 ENSP00000344762 ENSTTRP00000012755 ENSLAFP00000015242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]