SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000362900 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000362900
Domain Number 1 Region: 3-174
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.26e-35
Family Canonical RBD 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000362900
Sequence length 489
Comment SRSF4 (Homo_sapiens) serine/arginine-rich splicing factor 4
Sequence
MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDL
CGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDL
KDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSR
RRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSRSRSRSGSHSRSKSRTRSQSRSRSKK
EKSRSPSKDDKSRSRSHSANKSRSKSKDHTEDKIQNNDSTGKPKSRSPSRHESKSKSRSR
SQERRVEEEKRESMSRSQSQEKSRLKSRSRSRSKAGSRSRSRSKSKDKRKGRKRSREESR
SRSRSRSKSERSRKRSSKRDSKVTSSKKKKKEDTDRSQSRSRSRSVSKEREHAKAESGQG
EGQGESEDAGPNPETRSRSRSNSKSKPNPLTESRSRSKSASKTQSRSKSRSRSASRSPSQ
SRSRSHSRS
Download sequence
Identical sequences G5AP99
HGL_H00000362900 XP_004850839.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]