SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000362993 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000362993
Domain Number 1 Region: 66-143
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 815-877
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000471
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 3 Region: 203-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 4 Region: 16-70
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000362993
Sequence length 913
Comment BICC1 (Homo_sapiens) bicaudal C homolog 1 (Drosophila)
Sequence
LFTAAAEGKGRSGEDFFQKIMEETSTQIAWPSKLKIGAKSKKDPHIKVSGRKEDVKEAKE
MIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKS
NQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPVPDPSSPSIQHISQMYNISVS
FKQRSRMYGATVIVRGSQNNTSAVKEGTAMLLEHLAGSLASAIPVSTQLDIATQHHLFMM
GRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDM
KEEIEVDPQFIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLESS
GVTIATSPTPASCPAGLACPSLDILASAGLGLTGLGLLGPTTLSLNTSTTPNSLLNALNS
SVSPLQSPSSGTPSPTLWAPPLANTSSATGFSAIPHLMIPSTAQATLTNILLSGVPTYGH
TAPSPPPGLTPVDVHINSIQTEGKKISASLNGHSQTPNIKYGAISTTSLGEKMLSANHGD
PSIQTTGTEQASKSSPAEGCNDAFVEVGMPRSPSHSGNAGDLKQMMGPSKVSCAKRQTVE
LLQGTKNSHLHSTDRLLSDPELSAVESPLADKKAPGSERAAERAAAAQQNSERARLGSRP
SYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRANHV
SYKPTMTTTYEGSSVSLSRSNSREHLGNGSESDNWRDRNGIGPASASEFAASIGSPKRKQ
NKSMEHYLSSSNYMDCISSLTGSNGCNLNSSFKGSDLPELFSKLGLGKYTDVFQQQEIDL
QTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRRKLFEPPNARTSFLEGGASGRLPR
QYHSDIASVSGRW
Download sequence
Identical sequences G5BLB8
HGL_H00000362993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]