SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363105 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000363105
Domain Number 1 Region: 134-296
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.08e-25
Family Canonical RBD 0.000038
Further Details:      
 
Domain Number 2 Region: 26-130
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.03e-23
Family Canonical RBD 0.0094
Further Details:      
 
Domain Number 3 Region: 443-515
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000463
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363105
Sequence length 588
Comment A1CF (Homo_sapiens) APOBEC1 complementation factor
Sequence
MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFI
GKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKLEAKNAIKQLNNYE
IRNGRLLGVCASVDNCRLFIGGIPKTKKREEILSEVKKVTEGVVDVIVYPSAADKTKNRG
FAFVEYESHRAAAMARRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLML
STSEEIIEREFNNIKPEIWDYAFVHFSKREDAVEAMKALNGKVLDGSPIEVTLAKPVDKD
SYVRYTRGTGGRGTMLQGEYTYSLGHVYDPTTTYLGAPVFYAPQAYAAIPNLHFPATKGH
LSNRAIIRAPSVREIYMNVPVGAAGVRGLGGRGYLAYTGPGRGYQVKGDKREDKLYDLLP
GMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPA
LASQNPAIHPFTPPKLSAYVDEAKTYAAEYTLQTLGIPADGGDAGTAATAATSATIFPGY
AVPSATAPISAAQLKQAVTLGQDLAAYATYEVYPTFAVTARGDGYGPF
Download sequence
Identical sequences G5CAC5
HGL_H00000363105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]