SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363116 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000363116
Domain Number 1 Region: 282-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-68
Family Protein kinases, catalytic subunit 0.00000000362
Further Details:      
 
Domain Number 2 Region: 112-226
Classification Level Classification E-value
Superfamily SH2 domain 8.17e-35
Family SH2 domain 0.00000819
Further Details:      
 
Domain Number 3 Region: 74-116
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000228
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363116
Sequence length 531
Comment FGR (Homo_sapiens) Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
Sequence
MGCVFCKKVEPGSKEDVDLEEKFRSHGAADHYGPDPTQSWPASSFAQIPNYNNFSPQPTS
PAFLDGGTIRGISGTGVTLFTALYDYEARTEDDLTFNKGEKFHILNNTEGDWWEARSLSS
GHTGYVPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLLRESETTKGAYSL
SIRDWDQTRGDHVKHYKIRKLDTGGYYITTRAQFTSVQELVQHYMVGLTSTTMPAIPNPI
STCQNSTVSLKAQLEVTSYEVTVLIGIISPSGCHFFPWAPTCTWNGTTKVAVKTLKPGTM
SPKAFLEEAQIMKLLRHVKLVQLYAVVSEEPIYIVTEFMCHGSLLEFLKGREAQDLRLPQ
LVDMASQVASGMAYMERMNYIHRDLRAANILVGEQLACKIADFGLARLITDNEYNPQQGT
KFPIKWTAPEAALFGRFTIKSDVWSFGILLTEVITKGRVPYPGMINREVLEQVERGYHMP
CPPGCPVSLYEAMEQTWRLDPEERPTFEFLQSFLEDYFTSTEPQYQPGDET
Download sequence
Identical sequences G5AUU0
HGL_H00000363116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]