SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363241 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000363241
Domain Number 1 Region: 585-976
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.14e-30
Family Hermes transposase-like 0.0015
Further Details:      
 
Domain Number 2 Region: 482-558
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 2.75e-20
Family Hermes dimerisation domain 0.0068
Further Details:      
 
Domain Number 3 Region: 280-302,411-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000145
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 4 Region: 171-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000019
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363241
Sequence length 978
Comment ZNF618 (Homo_sapiens) zinc finger protein 618
Sequence
MVVVVVNLLICCPTGTGRSSCHGGAEVTSVVSETLQEFLKSSSQCGAPERERLKRSQKSA
KVEGPEPVPAEASLSAEQGTMTEVKVKTELPDDYIQEVIWQGEAKEEKKAISKDGTGDLP
AEICVVIGGVRNQQTLDGKAPEGSPHGGSVRSRYSGTWIFDQALRYASGSYECGICGKKY
KYYNCFQTHVRAHRDTEATSGEGASQSNNFRYTCDICGKKYKYYSCFQEHRDLHAVDVFS
VEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVA
LHAPISTAPGWEPPDDPDTGSECSHPEVTPSPRFVAAKTQANQAGKKAPASVVRCATLLH
RTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETNSSSQNSSEPYTCGA
CGIQFQFYNNLLEHMQSHAADNENNITPNQSRSPPAVVEEKWKPQGQRNSANNTTTSGLT
LNSMIPEKERQNIAERLLRVMCADLGALSVVSGKEFLKFAQTLVDSGARYGAFSVTEILG
NFNTLALKHLPRMYNQVKVKVTCALGSNACLGIGVTCHSQSVGPDSCYILTAYQAEGNHI
KSYVLGVKGADIRDSGDLVHHWVQNVLSEFVMSEIRTVYVTDCRVSASAFSKAGMCLRCS
ACALNSVVQSVLSKRTLQARSMHEVIELLNVCEDLAGSTGLAKETFGSLEETSPPPCWNS
VTDSLLLVHERYEQICEFYSRAKKMNLIQSLNKHLLSNLAAILTPVKQAVIELSNESQPT
LQLVLPTYVRLEKLFTAKANDAGTVSKLCHLFLEALKENFKVHPAHKVAMILDPQQKLRP
VPPYQHEEIIGKVCELINEVKESWAEEADFEPAAKKPRTAASEHPTAQDDDRLGKSEVYD
YLQEPLFQATPDLFQYWSCVTQKHTKLAKLAFWLLAVPAVGARSGCVNMCEQALLIKRRR
LLSPEDMNKLMFLKSNML
Download sequence
Identical sequences G5B1Y3
HGL_H00000363241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]