SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363344 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000363344
Domain Number 1 Region: 519-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 436-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-26
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.14e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 561-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 285-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 44-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000248
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 8 Region: 482-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000038
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363344
Sequence length 624
Comment ZFP37 (Homo_sapiens) zinc finger protein 37 homolog (mouse)
Sequence
MSASRCNRILTKPETMDQKSAGTADEAGHPPEMAVCKPEGRGAEEWEKLGPAQKDLYKDV
MLENYSNLASIGYQAPKPDICKLEKEEGAWSGKGKRSSQNHLSKLTRPKQTGASGNVQQD
DDQLENNQKSQDKLIKETIFKKTSTKKKSGECTSLEKKNNVSTKHSPSKKKFKFNSHRKN
LKQNIDSPGHIKYSAKKKSDVSKEQRKSLKHSLSDIKKDKNQVGKKHDKLSNHTSFDKYD
KTQTVKKQEKLYDHCSSCTKKDKLQMGEKHEKSSTKTDKTQACVKPYECNQCGKVLSHKQ
GLIDHHRTHTGEKPYECNECGIAFSQKSHLVVHQRTHTGEKPYECVQCGKAHGHKHALTD
HLRIHTGEKPYKCSECGKSFRHSSNLIQHARSHTGEKPYECKECGKSFRYNSSLTEHVRT
HTGEIAYECNECGKGFKYSSSLTKHMRIHTGEKPFECNECGKTFSKKSHLIIHQRTHTKE
KPYKCDECGKAFGHSSSLTYHMRTHTGENPFECNQCGKAFKQIEGLTQHQRVHTGEKPYE
CNECGKAFSQKSHLIVHERTHTGEKPYECNECGKAFNAKSQLVIHQRSHTGEKPYKCNEC
GKAFKQNISLTKHMKTHLEEKAHE
Download sequence
Identical sequences G5BWR0
HGL_H00000363344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]