SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363635 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000363635
Domain Number 1 Region: 12-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.21e-30
Family Thioltransferase 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363635
Sequence length 112
Comment TXNDC8 (Homo_sapiens) thioredoxin domain containing 8 (spermatozoa)
Sequence
MRFSDYTHFFIVLFQNELTAFLKAAGHKLVVVEFSAKWCGPCKLMAPIFHAMSLKYKNVV
FAKVDVDESQELAEFCNIKAIPTFKMFKQTQKIFEFCGADPKNLEAKIQELM
Download sequence
Identical sequences G5C093
HGL_H00000363635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]