SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363727 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000363727
Domain Number 1 Region: 772-964
Classification Level Classification E-value
Superfamily Bet v1-like 3.02e-50
Family STAR domain 0.0000009
Further Details:      
 
Domain Number 2 Region: 532-733
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00054
Further Details:      
 
Domain Number 3 Region: 3-71
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.59e-30
Family Variant SAM domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363727
Sequence length 976
Comment STARD8 (Homo_sapiens) StAR-related lipid transfer (START) domain containing 8
Sequence
MTWSKEAEAKRACEWLRATGFPQYAQLFEEGSFPLDIGSVKKDHGFLDEDSLGALCRRLM
TLNNCASMQLEVHFQSKQNEDSEEEEQCTISSYWTFQQESKPWSHVGSSDLLAPPNPSLP
VTSSCESVLIELSATSLPAISMSLPPEQVNLPLLAWVPSSSDQPLLSLPQGQVYRGNYLV
HVPGDHKPGTFPRSLSIESLCPEDGHCLEDWQPGRHWGYEGRRGSCGSTGSHASTYDNLP
ELYPAEPILTGAKAEEEEEGGDSYAHLDDILQHVWGLQQRVELWSQAMYPELGPRDKEEE
EEEEEEEATSSVEIATAEVEDKPEALVPSEAPACGEFPAQVQAEVQPTILAQGPADAGRL
AQAEAEPQDNEQETNSGGEPTSASSLSVEEAHSISDTMASASELDSSGNSMNETEAAGSL
VGLQASVPRERRDSGVGASLTRPCRKLRWHSFQNSHRPSLNSESLEINRQFAGQIKLLHK
GSLLRLTAFMEKYTVPHKQGWIWSVPKFMKRNKTPDYRGQHVFGVPPLIHVQRTGQPLPQ
SIQQAMRYLRSQCLDQVGIFRKSGVKSRIESLRQMNENSPDNVCYEGQSAYDVADLLKQY
FRDLPEPIFTSKLTTTFLQIYQLLPKDQWLAAAQAATLLLPDENREVLQTLLYFLSDIAS
AEENQMTAGNLAVCLAPSIFHLNVSKKDSLSPRIKSKRSRVGRPGPRDLSENMAATQGLS
HMISDCKKLFQVPQDMVVQLCGSYSAAELSPPGPALAELRQAQAAGVSLSLYMEESVQEL
LHDAAERFKGWMSVPGPQYTELACRKAPDGHPLQMWKVSTEVAAPPAVVLHRVLRERALW
DEDLLRAQVLEALMPGVELYHYVTDSMAPHPCRDFVVLRMWRSDLPRGGCLLVSQSLDPE
QPVPESGVRALMLTSQYLMEPCGLGRSRLTHICRADLRGRSPDWYNKVFGHLCAMEVTKI
RDSFPTLQAAGPETKL
Download sequence
Identical sequences G5B0H9
HGL_H00000363727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]