SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363752 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000363752
Domain Number - Region: 272-368
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0489
Family ADP-ribosylating toxins 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363752
Sequence length 1072
Comment LUZP1 (Homo_sapiens) leucine zipper protein 1
Sequence
MAEVASYKDTSSSRHLRFKLQSLSRRLDELEEATKNLQKAEDELLDLQDKVIQAEGSNSS
MLAEIEVLRQQVLRIEGKDEEIKKAEDLCHLMKEKLEEEENLTRELKSEIERLQKRMAEL
EKLEEAFSRSKNDCTQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQNLV
SELEKLKSLTLSFVSERKYLNEKEKENEKLIKELTQKLEQNKKMNRDYTRNASNLLERND
LRIEDGISSALPSKESRRKGALDYLKQVENETRNKSENEKNRNQEDNKVKDLNQEIEKLK
TQIKHFESLEEELKKMRAKNSDLQDNYLSEQNKNKILASQLEEIKLQIKKQKQLENGEIE
REDAFLSSKGRHERTKFRGHGGEACGSKYPSRELSPQHKRERLRNREFALHSENYSVSNR
HVSSPTFTSRRVAKASNMVAGTESGAQETKRTEDRFAPGSSQSDGKKAREQPSVLSRYPP
AAQEHSKVWKGTPKPGTESGLKGKVEKTTRTFSNSTHGSVPSDTLDRADKASDTLSEAHF
SKRAQVPDSESQVTPATDHVCSKATGALASSRRSSSEGLSKGKKAANGLEADTGSPTSKA
SILSKYPYSSRSQENILQGFSTPNKEVEQPVAVVMEDSSHHEALRCRVIKSSGGEKPDSD
DDLDMASLVTAKLVNTTITPEPEPKLPPTPREKAKSRGEHRISRFENDKNTGIESESVKP
VRASSNAVELADANGAGVKSQRPFSPREALRSRGVIKPVIIDKNVKKIMGGSGTEAVLEK
QKLTSKPGPNKVTSSITIYPCDSSSPRAGPGEALRERHTSTSNIQVGPAELMPVSNHVSS
PFELSIHKHDITVQLTEAERLGDGSSKNRPDMVVSRSSILIKPSDSVERNSHATPAETIR
WKSHSTPSEGGSSDTRHITVRNAWKTKEDLKSFEDAPTQVGRNMESTNTYIQRSSTDFSE
LEQPRSYLSESGIRRVGNSGDAAELSSRRTQSSLTVSEVLTHRSRAGDRVMAAAWNHSAG
MEEGEDCALSVHRRLHNSLEQSEWPVKPGLPELGRVRAEERLRPSRPCAEEN
Download sequence
Identical sequences G5BHZ3
HGL_H00000363752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]