SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363925 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000363925
Domain Number 1 Region: 1-198,247-299,568-591
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-26
Family ABC transporter ATPase domain-like 0.00056
Further Details:      
 
Domain Number 2 Region: 527-607
Classification Level Classification E-value
Superfamily Smc hinge domain 2.75e-22
Family Smc hinge domain 0.0021
Further Details:      
 
Weak hits

Sequence:  HGL_H00000363925
Domain Number - Region: 598-794
Classification Level Classification E-value
Superfamily Tropomyosin 0.00458
Family Tropomyosin 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363925
Sequence length 881
Comment SMC2 (Homo_sapiens) structural maintenance of chromosomes 2
Sequence
MHIKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRAS
NLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGV
NANNTRVQDLFCSVGLNVNNPHFLIMQILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLK
EIKTVIKLVSNTFEEECSFAFGVSAILEEEITPTIQKLKEERSSYLEYQKVIREIEHLSR
LYIAYQFLLAEDTKERSAEELKEMQDKIIKLQEKLSENDKKIKALNHEIEELEKRKDKEI
GGILRSLEDALAEAQRVNTKSQSAFDLKKKNLASEENKRQELEKNLVEDSKTLAAKEKEV
QSITDGLHGLQEASDKDAEALAAAQQHFNAVSAGLSSNEDGAEATIAGQMIACKNDISKA
QTEAKQVNTDTKHYELKNKQVEVKKMDGGYRKDQEALEAVKRLKEKLETEMKKLNYEEKK
EENLLEKRRQLSHDISRLKETYEALLARFPNLQFAYKLVLTMFMWLFPVDYKPELQKAME
FVFGTTFVCDNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQEL
KDVQDELRIKEKELQVLEEELARLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQ
QEELDALKKTIAESEETLKNTKEIQKKAEEKYEILENKMKNAEAEREKELKDAQKKLDCA
KTKADASSKKMKEKQQEVEAITLELEELKREHASYKQQLEAVNEAIKSYAGQIEVMAAEV
AKNKESVSKAQEEVTKQKEVIVAHDSVIKTKYAEVAKHKEQNNDSQLKIKELDHNISKHK
REAEDAASKACLYSFLPLIKFFVLRLLENSRKLLNEETQYK
Download sequence
Identical sequences G5AR32
HGL_H00000363925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]