SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000364158 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000364158
Domain Number 1 Region: 22-61,88-161,196-299
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-50
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 643-706
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000013
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000364158
Sequence length 826
Comment ANKS6 (Homo_sapiens) ankyrin repeat and sterile alpha motif domain containing 6
Sequence
MVCKISAAQSIKKLRWRNNRFGHVSVAHLLLDHGADVNAQNRLGASVLTVASRGGHLGVV
KLLLEAGAFVDYHSPSSEQLGLGGGRDELLDITALMAAVQHGHEAVVRLLLEWGADPNHV
AWTVGWSPLMLAALAGRLSVAQQLVEKGANPDHLSVLEKTAFEVALDRRHRDLADCLDPL
TTVRPRTDEEKRRPDIFHALKMGNFQLVKEIADEDPNHVNLINGDGATPLMLAAVTGQLP
LVQLLVERHADIDKQDSVHGWTALMQATYHGNKEIVKFLLNQGADVTLRAKNGYTAFDLV
MLLNDPDTELVRLLASVCMQVHKDKGRPSHPPPLPHSKVREPWSIPVLPDDKGGLKSWWN
RMSNRFRKLKLMQTLPRGLSSNQPLPFADEPEPALDSTMRVNTQDKTGFPGLPSAALVTK
EKGPGSVRGEKEDALLTTLLRNGAPFTRLPSDKLKAVIPPFLPPSSFELWSSDRSRTDQN
GKAEPMKTVLPQRASRGHPLGSGGSDATLVRPVKFASLSRSPASPANSGSFNHSPHSSGG
SSAVGGVSRHGAELHNRSGGSVDSVLSQIAAQRKKAARLSEQKPSQRSSPVGPAPGSNPS
ELPVSPADSSVPGSKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEK
YQPIFEEQEVDMEAFLTLTDGDLQELGIKTDGSRQQILAAISELNASKGRERQILQETIH
NFHSSFESSASNTRAPGNSPLKKHTQKLPRLPNNLVLIRGCPDSLQKSRSVDIIWCNSLT
ECLREPSCRATGSQDSAPASEESRFPTSSSHCGVQRASAGFAFQSL
Download sequence
Identical sequences G5AZ19
HGL_H00000364158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]