SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000364416 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000364416
Domain Number 1 Region: 3402-3511,3887-4041,4150-4350
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000107
Family HspBP1 domain 0.076
Further Details:      
 
Domain Number 2 Region: 1949-2069
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000227
Family WD40-repeat 0.031
Further Details:      
 
Weak hits

Sequence:  HGL_H00000364416
Domain Number - Region: 1287-1520
Classification Level Classification E-value
Superfamily ARM repeat 0.00101
Family Leucine-rich repeat variant 0.086
Further Details:      
 
Domain Number - Region: 643-696,806-864,1129-1191,1283-1388,1417-1458
Classification Level Classification E-value
Superfamily ARM repeat 0.0164
Family GUN4-associated domain 0.068
Further Details:      
 
Domain Number - Region: 609-617
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000364416
Sequence length 5193
Comment UBR4 (Homo_sapiens) ubiquitin protein ligase E3 component n-recognin 4
Sequence
MATSGGEEVAAASAPAPGAPATGADTTPGWEVAVRPLLSASYSAFEMKELPQLVASVIES
ESEILHHEKQYEPFYSSFVALSTHYITTVCSLIPRNQLQSVAAACKVLIEFSLLRLENPD
EACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASP
VSPELKQKEVQMNFLNQLTSVFNPRTVTSPPISPQALVEGENDEQSSTDQASAIKTKNVF
IAQNVASLQELGGSEKLLRVCLNLPYFLRYINRFQDAVLANSFFIMPATVADATAVRNGF
HSLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCLYAGVSVATCMAILHVGSAQQVR
TGSTSSKEEDYESDAATIVQKCLEIYDMIGQAISSSRRAGGEHYQNFQLLGAWCLLNSLF
LILNLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSPKLGPGKGHQGFGVLSVILANH
AIKLLTSLFQDLQVEALHKGRETDDPPAVLSIMAQSTSIQRIQRLIDSVPLTNLLLTLLS
TSYRKACVLQRQRKGSMSSDASASTDSNTYYEDDFSSTEEDSSQDDDSEPILGQWFEETI
SPSKEKVAPPPPPPPPPLESSPRMKSPSKQAVGEKGNILASRKDPELFLGLASNILNFIT
SSMLNSRNNFIRNYLSVSLSEHHMATLASIIKEVDKDGLKGSSDEEFAAALYHFNHCLVT
SDLQSPNLQNTLLQQLGVAPFSEGPWPLYIHPQGLSVLSRLLLIWQHKASTQGDPDVPEC
LKVWDRFLSTMKQNALQGVVPSETEDLNIEHLQLLLLIFHHLSEKGRRAILTLFVQIIQE
LSVNIDAQMHSVPLILARLLLIFDYLLHQYSKAPVYLFEQVQHNLLSPPFGWASGSQDSS
SRRATTPLYHGFKEVEENWSKHFSSDTVPQPRFYCVLSPEASEDDLNRLDSVACEVLFSK
PVKYDELYAALTALLAAGSQLDTVRRKENKNVTALEACALQYYFLILWRILGILPPSKSY
MNQLAMNSPEMSECDILHTLRWSSRLRISSYVNWIKDHLIKQGMKAEHSGSLIELASTKC
SSVKYDVEIVEEYFARQISSFCSIDCTTILELHEIPSLQSIYTLDAAISKVQVSLDEHFS
KMAAETDPHKSSEITKNLLPATLQLIDTYASFTRAYLLQNFNEEGTADKPSKEKLHGFAA
VLAIGSSRCKANTLGPTLVQNLPSSVQAVCESWNNINTNEFPNIGSWRNAFANDTIPSES
YISAVQAAHLGTLCGQSLPLAASLKHTLLSLVRLTGDLIVWSDEMNPPQVIRTLLPLLLE
SSTESVAEISSNSLERMLGPSESDEFLARVYEKLITGCYNILANHADPNSGLDESILEEC
LQYLEKQLESTQARKAMEEFFSDSGELVQIMMATANENLSAKFCNRVLKFFTKLFQLTEK
SPNPSLLHLCGSLAQLACVEPVRLQAWLTRMTTSPPKDSDQLDVIQENRQLLQLLTTYIV
RENSQVGEGVCAVLLGTLTPMATEMLANGDGTGFPELMVVMATLASAGQGAGHLQLHNAA
VDWLGRCKKYLSQKNVVEKLNANVMHGKHVIVLECTCHIMSYLADVTNALSQSNGQGPSH
LSVDGEERAIEVDSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCH
TCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSAM
KESAFQSEPRASESLVRHASTSPADKAKVTISDGKVADEEKPKKSSLCRTVEGCREELQN
QANFSFAPLVLDMLTFLMDAIQTNFQQASAVGSSSRAQQALSELHTVDKVVEMTDQLMVP
TLGSQEGAFENVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGKI
TVLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFS
SSGSVSDHLVLHPQLATGNFIIKSVWLPGSQTELAIVTADFVKIYDLSVDALSPTFYFLL
PSSKIRDVTFLFNEEGKNIIVIMSSAGYIYTQLMEEASSAQQGPFYVTNVLEINHEDLKD
SNSQVAGGGVSVYYSHVLQVLFFSYCQGKSFAATISRTTLEVLQLFPINIKSSNGGSKTS
PALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIKTLPAKAKIQDMVAIRHTA
CNEQQRTTMILLCEDGSLRIYMANVENTSYWLQPSLQPSSVISIMKPVRKRKTATITTRT
SSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEIN
NNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADKKL
NLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEEFPSASVSNICPSNLNQSNGTGD
SDSAAPATTSGTVLERLVVSSLEALESCFAVGPIIEKASHFFTAHGSFLKRQEERNKNAA
QELATLLLSLPAPASVQQQSKSLLASLHTSRSAYHSHKDQALLSKAVQCLNTSSKESKDL
DPEVFQRLVITARSIAIMRPNNLVHFTESKLPQMETEGVDEGKEPQKQVEGDCCSFITQL
VNHFWKLHASKPKNAFLAPACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQM
LLCPDPAVSFSCKQALIRVLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSG
IPDGGHIRQESQEQSEVDHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPMLD
IPPDADDETMVELAIALSLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTASA
PASDDEGSTAATDGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEG
HPAGPGSVSSSTGAISTTTGHQEGDGSEGEGEGETEGDVHISNRLHMVRLMLLERLLQTL
PQLRNVGGVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLSQLITELGMDKKDVSKKNER
SALNEVHLVVMRLLSVFMSRTKSGSKTSICESSSLISSATAAALLSSGAVDYCLHVLKSL
LEYWKSQQNDEEPVATSQLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQLLTEMVL
RLPYQIKKIADTNSRIPPPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYR
QLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQ
RTINWQKFCIKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALKVAALAASTGSSSVASST
PVATSSGQTTTQSKSSTKKSKKEEKEKEKDGESSGSQEDQLCTALVNQLNKFADKETLIQ
FLRCFLLESNSSSVRWQAHCLTLHIYRNSSKSQQELLLDLMWSIWPELPAYGRKAAQFVD
LLGYFSLKTLQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESD
PCLVCNNPEVPFCYIKLSSIKVDTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTV
NLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYEN
YQASTETLQCPRCSASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYAR
FDFMLYAKPCCAVDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLLCKVNEA
APEKPQEDSGTAGGISSTSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLE
YDLQQREAATKSSRTSVQPTFTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRAL
ATNPALRHILVSQGLIRELFDYNLRRGPATMREEVRQLMCLLTRDNPEATQQMNDLIIGK
VSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFLMAVNIKTPVVVE
NITLMCLRILQKLIKPPAPTSKKNKDVSVEALTTVKPYCNEIHAQAQLWLKRDPKASYEA
WKKCLPIRGIDGNGKSPSKSELRHLYLSEKYVWRWKQFLSRRGKRTTPLDLKLGHNNWLR
QVLFTPATQAARQAACIIVEALATIPSRKQQVLDLLTSYLDELSIAGECAAEYLALYQKL
ITSPHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTGLLSSFVE
VESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFM
AVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGN
PYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWC
TTNEGEPMRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLN
RLAGIKDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQES
KDSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNP
SVLQGLLRIIPYLSFGEVEKMQILVERVKPYCNFDKYDEDHSGDDKVFLDCFCKIAAGIK
NNSNGHQLKDLILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLFWGLA
IQHPATQVLIGTDSITNLHKLEQVSSDEGIGTLAENLLEALREHRDVNKKIDAARRETRA
EKKRMAMAMRQKALGTLGMTTNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQPT
KVLGIYTFTKRVALEEMENKPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQ
NANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAM
EQSFSADTGGGGRESNIHLIPYIIHTVLYVLNTTRATSREEKNLQGFLEQPKEKWVESAF
DVDGPHYFTVLALHVLPPEQWRATRMEILRRLLATSQARAVAPGGATRLTDKAMKDYSAY
RSSLLFWALVDLIYSMFKKVPTSNTEGGWSCSLAEYIRHNDMPIYEAADRALKTFQEEFM
PVETFSEFLDVAGLLSEITDPESFLKDLLNSIP
Download sequence
Identical sequences G5BZM0
HGL_H00000364416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]