SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000364448 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000364448
Domain Number 1 Region: 66-153
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.58e-29
Family Smg-4/UPF3 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000364448
Sequence length 428
Comment UPF3A (Homo_sapiens) UPF3 regulator of nonsense transcripts homolog A (yeast)
Sequence
MRSEETFGGLSAVVTAQSPGGREKLSAAEVQFHRESPRREPRTPPASSGSGGGTVKPREE
KRTVLSKVVLRRLPPGLTKEQLEEQLRPLPAHDYFEVAGADRSLYPHLYSRAYINFRNPD
DILLFRDRFDGYVFMSSKGLEYPAVVEFAPFQKIVRRKLKKRDSKTGGIEDDPEYKQFLE
TYSMEEERTSANPEILLGEIEAKTRELVARRTTPLLDYIKNRKLEKQRIREEKREERRRR
ELEKKRLQEEEKRKRREEESYRRKEADKQKTTMETEVRIKLLKKPEKEEEPDTEKQKERG
EEVSIGDGEQETCAPCTFVRARPSESPVGVPREKSHDDNDKEQRDMERRIQGPETPECHS
DDVRKHSGHSEFDRFPRRNEDELRWQDRGKKKSQDGGIPVGTAESPAREQEGACSPALGR
ERPGSRAL
Download sequence
Identical sequences G5AVU4
HGL_H00000364448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]