SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000364536 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000364536
Domain Number 1 Region: 1082-1237,1279-1355
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-39
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 1405-1654
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-37
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 18-161,231-300
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-32
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 635-782,816-863
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-29
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 5 Region: 2638-2723
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000029
Family Voltage-gated potassium channels 0.028
Further Details:      
 
Weak hits

Sequence:  HGL_H00000364536
Domain Number - Region: 2731-2777
Classification Level Classification E-value
Superfamily EF-hand 0.0078
Family Calmodulin-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000364536
Sequence length 2947
Comment SCN9A (Homo_sapiens) sodium channel, voltage-gated, type IX, alpha subunit
Sequence
MVSEALEDLDPYYADKKFPNMLIMCTILTNCIFMTMSSPPEWTKNVEYTFTGIYTFESLI
KILARGFCVGEFTFLRDPWNWLDFVVIVFAYVTEFVDLGNVSALRTFRVLRALKTISVIP
GLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRHKCVQLEFAENETAISA
LDNFENKEDLKKYVYYLEGSKDALLCGFSTDSGQCPEGYKCVKLGRNPDYGYTSFDTFSW
AFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQN
QANIEEAKQKELEFQQMLDQLKREQEEAEAIAVAAAEYTSIGRSQIMGLSESSSETSKLS
SKSAKERRNRRKKKNQKKLSSGEEKRDDEKLSKSESDGSVRRKSFFLGVEGPRQAREKRL
STPNQSPLSIRGSLFSPRRSSRTSLFSFKGRGKDIGSETEFADDEHSIFGDNESRRGSLF
LPPRFRERRSSNISQASRSPPMLPVNGKMHSAVDCNGVVSLVDGPSALMLPNGQLLPEVI
IDKATSDDSGTTIQIRKKRCSSSYFLSEDMLNDPHVRQRAMSRASILTNTVEELEESRQK
CPPWWYRFAHTFLIWNCSPYWIKFKKFIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMT
LEFKNVLSVGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLSHVE
GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSMGALGNLTLVLAIIVFIFAVVGMQLFG
KSYKECVCKINEDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYM
MVMVIGNLVVLNLFLALLLSSFSSDNLTAIEDDPDANNLQIAVARIKKGIDYVKQTAREF
ILKAFSKKPKVPQVVRQVEDLNSKKENCISNHTLAEMSKDSHFHKENEKSSGFESSVDRN
LVEESDYQSFIHNPSLTVIVPIAPGESDLENMNTEELSSDSDSDYSKERLNRSSSSECST
VDNPVPGEGEEAESEPVNSDEPEACFTDGCVRRFPCCQVSIESGKGKIWWNIRKTCYRIV
EHSWFESFIVLMILLSSGALAFEDIYIEKKKTIKIILEYADKIFTYIFILEMLLKWVAYG
YKTYFTNAWCWLDFLIVDVSVVTLVASTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRV
VVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECVNTTDGLRFLDSQVHNRSE
CFALMNVTSDVRWKNLKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSVNEDQQPRYEY
NLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKISQDIFMTEEQKKYYNAMKKLGS
KKPQKPIPRPGNKFQGCIFDLVTNQAFDITIMVLICLNMVTMMVEKEGQSDEMINVLYWI
NVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFR
VIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVK
KEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKEHPGSSVKGDC
GNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGIDDMFNF
ETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKEHPGSSVKGDCGNPSVGIFYFV
SYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEYSK
LSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRS
QMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRHYRLRKNVKNISSIYMKDGD
RDDDLPNKEEIVFDNVNGNSSPEKTDATASTISPPSYDSVTKPEQEKYETDKTEKEDKGK
DGKDSKK
Download sequence
Identical sequences HGL_H00000364536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]