SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000364860 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000364860
Domain Number 1 Region: 463-765
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.67e-71
Family Protein kinases, catalytic subunit 0.000000436
Further Details:      
 
Domain Number 2 Region: 300-422
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 88-176
Classification Level Classification E-value
Superfamily Immunoglobulin 6.61e-22
Family I set domains 0.029
Further Details:      
 
Weak hits

Sequence:  HGL_H00000364860
Domain Number - Region: 194-281
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00497
Family Frizzled cysteine-rich domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000364860
Sequence length 963
Comment ROR2 (Homo_sapiens) receptor tyrosine kinase-like orphan receptor 2
Sequence
MQLRQQLSASPPFPAPLCSPLYLNGLGLLASVSFLAVIESSSTLTGVQPAREHGALPDSR
HFSPYRCPFEGQRGHAGAGYFLNFLEPVNNITIVQGQTAVLHCKVAGNPPPNVRWLKNDA
PVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGVKTITATGVLYVRLGPTHSP
NHNFQDDYQEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLS
DQCSQFAIPSFCHFVFPLCDSRSRAPKPRELCRDECEVLESDLCRREYTIARSNPLLLMR
LQLPKCEVLPMPESPDAANCMRIGIPVERLGRYHQCYNGSGSDYRGTASTTRSGHQCQPW
ALQHPHSHQLSSSDFPELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSS
KMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASGSVPQRRQLMASPSQDMELPLISQH
KQAKLKEISLSAVRFMEELGEDRFGKVYKGHLFGPGPSEQTQAVAIKTLKDKAEGPLREE
FRHEAMLRARLQHPNIVCLLGVVTKDQPLSMIFSYCSHSDLHEFLVMRSPHSDVGSTDDD
RTVKSALEPPDFVHVAAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLTVKISDLGLFREV
YSADYYKLMGNSLLPIRWMSPEAIVYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQD
VVEMIRSRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSQLRAWGNLSNYNSSAQ
TSGASNTTQTSSLSTSPVSNVSNARYVGPKQKAQPFPQPQFIPMKGQIRPMVPPPQLYIP
VNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSN
TSVADRAALLAEGTEDTQNIPEDMAQSPVQEAEEQEEGSVPETELLGDNDTLQVDEALVQ
LEA
Download sequence
Identical sequences G5AU73
HGL_H00000364860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]