SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000365012-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000365012-2
Domain Number 1 Region: 266-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-79
Family Protein kinases, catalytic subunit 0.000000000204
Further Details:      
 
Domain Number 2 Region: 116-154,195-298
Classification Level Classification E-value
Superfamily SH2 domain 1.07e-32
Family SH2 domain 0.00000386
Further Details:      
 
Domain Number 3 Region: 58-140
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-21
Family SH3-domain 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000365012-2
Sequence length 543
Comment HCK (Homo_sapiens) hemopoietic cell kinase
Sequence
MGCLKSKFLRDRGKISKTEPSSNLHTPVYVPDPTSSVKLGPNSNSNPPGLMEAGSEDFIV
VALYDYDAIHREDLSFQKGDQMVVLEESGEWWRAQSLATQKEGYIPSNYVARVNSLETEE
WFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKEQLGDKLMYPSSKGKETKKPSQACGE
GSELGPGFMACHSGGSYSLSVRDCDPQQGDTVKHYKIRTLDNGGFYVSPRSTFSSLQDLV
AHYKKGKDGLCQKLSFPCVSSKPQKPWEKDAWEIPRESLKLEKRLGAGQFGEVWMATYNQ
HTKVAVKTMKPGSMSVEAFLEEANIMKTLQHDKLVKLHAVVTQEPIYIITEFMAKGSLLD
FLKSEEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSALLVCKIADFGLA
RVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSN
PEVIRALEHGYRMPRPDHCPEELYNIMTRCWKNRPEERPTFEYIQSVLDDFYTATESQYQ
QQP
Download sequence
Identical sequences G5BR07
HGL_H00000365012-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]