SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000365441 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000365441
Domain Number 1 Region: 1126-1373
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-33
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 806-961,1001-1077
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 466-695
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.69e-29
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 34-165,212-283
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.73e-26
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  HGL_H00000365441
Domain Number - Region: 1381-1485
Classification Level Classification E-value
Superfamily EF-hand 0.0044
Family Polcalcin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000365441
Sequence length 1915
Comment CACNA1F (Homo_sapiens) calcium channel, voltage-dependent, L type, alpha 1F subunit
Sequence
MVAVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPED
DSNTANHNLEQVEYVFLVIFTMETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLSQP
PPPTGLHIVLNSILKALVPLLHIALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDVEVE
EDPSPCASSGSGRACTLNQTECRGRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLY
WMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQM
EEDLQGYLDWITQAEELDLEDPSADGNLGSMAEEGQAGHRPQLAELTNRRRGHLRWFSHS
TSSTHSTSSHGPQLAELTNRRRGHLRWFSHSTSSTHSTSSHASLPASDTGSMTETPGDED
KEEGALASCTRCLNKIMKTRVCRRLRRANRGLRARCRRAVKSNACYWAVLLLVFLNTLTI
ASEHHGQPVWLTQTQECANKVLLCLFTAEMLLKLYGLGPSVYVASFFNRFDCFVVCGGIL
ETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLRNLVASLLNSMKSIASLLLLLFLF
IIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDGIMAYGG
PFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKDKGREKSSEGNAPQEN
GVLVLVGKNEEEKAAKSEGASKLAGPVPGVEEEEEEEEEEGSVGHVELLQEVVPKEKVVP
IPEGSAFFCLSQTNPLRKACHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAHSFRNHIL
GYFDYAFTSIFTVEILLKMTVFGALLHRGSFCRSWFNLLDLLVVSVSLISFGIHSSAISV
VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKG
KFYGCTDEAKQTPKECKGSFLIYPDGDVSRPLVQERLWVNNDFNFDNVLSAMMALFTVST
FEGWPALLYKAIDAHAEDEGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQG
EQEYQNCELDKNQRQCMEYALKAQPLRRYIPKNPQQYRVWATVNSAAFEYLMSLLILLNT
VALAMQHYEQTAPFNYAMDILNMIFTGLFTIEMVLKIIAFKLKHYFADAWNTFDALIVVG
SIVDIAVTEVNSSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVA
LLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLA
SLPGNRCDPESDFAPGEEFTCGSNFAIVYFISFFMLCAFLIINLFVAVIMDNFDYLTRDW
SILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRCIQPPLGFGKLCPHRVACKRLVAM
NVPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRMVIKKIWKQIKQKLLDEVIP
LPEEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGAEAPSSMSSVLQVFGAGLRSLQDLG
PEMRQALTCDTEEEEEEKEEERQEGVEEEAEKDPETYKGPVGSQPSSHSRISVSLPVGDS
LPDLPSPRPSDEDRGDPKSRHPSVPQPGSHSHRRSSGVLMFTIPEEGSPEPKGTKGHDKQ
DEEGEIPDRLYYLDEQAGTPPRTPPHSVLLPPHRPQRYGNGHHMPRRRLLPPTPAGQKPS
FPIQCLQRQGSCEDLPIPGTYHRGQKLGLSRAQGSWATPPQRGRLVYAPLLVVEEGAAGE
DYLGKSGGPLRTFTCLHVPRTHSNPSYSKRSSADSLVEAVLISEGLGLFAQDPCFVALAK
QEIADACRLTLDEMDSAASDLLAQGTCSLYSDEESILSCFDDDDLGDEMACVHAL
Download sequence
Identical sequences G5BJK1
HGL_H00000365441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]