SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000365444-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000365444-1
Domain Number 1 Region: 360-438
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.09e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000101
Further Details:      
 
Domain Number 2 Region: 139-218
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 3 Region: 38-110
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000506
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000365444-1
Sequence length 445
Comment HNRNPK (Homo_sapiens) heterogeneous nuclear ribonucleoprotein K
Sequence
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDDVFELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPECILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYKHYKGSDFDCDLRLLIHQSLAGGIIGVKGVKIKEFRENTQTTIKL
FQECCPHSTDRVVLIGGKSDRVVECTKIILDLISESLVKGGAQRYDPNFYDETYDYGGFT
MMFDDRQWTACRISHAGKRRDYDDMSPCRGPPHPPPGRGGRGGSRAWNLPLPPPPPPRGD
LMACDRRERPGDRYDGMVGFSADETWDSAIDTLSPSEWQMSYEPQGGSGYDYSYAGGHGS
YGDLGGPIITTQVTIPKDLAGSIIGKGAQQIKQIRHESGVSIKIDEPLEGSEDRIITITG
TQDQIQNAQYLLQNSVKQYADVEGF
Download sequence
Identical sequences G5ALR5
HGL_H00000365444-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]