SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000365444-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000365444-3
Domain Number 1 Region: 133-216
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000136
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 32-104
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Weak hits

Sequence:  HGL_H00000365444-3
Domain Number - Region: 283-288
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000365444-3
Sequence length 403
Comment HNRNPK (Homo_sapiens) heterogeneous nuclear ribonucleoprotein K
Sequence
METEQPEETFGNIETRRAEDMEEEQAFKRSRNTDEMAELRILLQRKNAGAVTGKGGKNIK
ALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLE
SDPVECLNYQHHKGSDFDCELRLLIHQSLAGGITGVKGAKIKELRENTQTAIKLFQECCP
HSTDQVVLIRGKPDRVVECIKIILDLISECPIKGRVQPYDPNFYNETYDYNGFTMMFDDC
HGRPVGFPMRGRGGFDRMPPGRGRRPMPPSRRDYDDISPRQEPPPPPPGRGGQGGSRARN
LPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSECQMAYEPQGG
SGYDYSYAGGRGSYGDLGGPIITTQVTIPKSGWIYYWQSWSAD
Download sequence
Identical sequences HGL_H00000365444-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]