SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000365745 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000365745
Domain Number 1 Region: 600-653
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-22
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000365745
Sequence length 655
Comment CTTN (Homo_sapiens) cortactin
Sequence
MLRRAAAASGELGISNRLSFLGVCQGTRKKRELQKALELVVGGISQTSHLHLPRILLHVA
GATRPDVIKQVEGLPSCLVKLVSRKISDCALSLSLMNLKKKQAATIILDLGMWKASAGHA
VSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTL
KEKELETGPKASHGYGGKFGVEQDRMDKRLSFGLGFPGPALIALTCAWPGVMQGAQEHVS
AVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGF
GGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGK
TEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKD
RMDKNASTFEDVAQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQ
RMAKERQEQEEARRKLEEQARAKKETPPASPTPQLAEERRPSSPIYEDAASFKAELSRRG
PASVSELEPVYSAEATNYTEASSQQGLAYAPEAVYDTTEASGHYQAEENTYDEYENDLGI
TAIALYDYQAAGDDEISFDPDDIISNIEMIDDGWWRGVCKGRYGLFPANYVELRQ
Download sequence
Identical sequences G5BSS7
HGL_H00000365745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]