SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366118 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000366118
Domain Number - Region: 23-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0017
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366118
Sequence length 194
Comment SSX1 (Homo_sapiens) synovial sarcoma, X breakpoint 1
Sequence
MNRGSSFSKSPREDTLKSEKIYKIFGEISKYFSESQWGKLSYLDKITCVCLKRNYNTMSN
LGNGLATLPTFMRNHKGAKPTCKGNSDEASSHGTQGSKVLKKKSLILLICGLDIKKKSKK
PAKKRNDPKTVAGAPDKEQAGRTKGPRGEASTSGKKHTKISGERKRKVSVWSKQLREWKN
LMVYEEISDPEEED
Download sequence
Identical sequences G5BJG8
HGL_H00000366118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]