SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366135 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366135
Domain Number 1 Region: 180-488
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.57e-85
Family DnaQ-like 3'-5' exonuclease 0.000000479
Further Details:      
 
Domain Number 2 Region: 484-580
Classification Level Classification E-value
Superfamily HRDC-like 3.49e-26
Family EXOSC10 HRDC domain-like 0.00000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366135
Sequence length 882
Comment EXOSC10 (Homo_sapiens) exosome component 10
Sequence
MALSSPRESKAQAAPSATKPDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEY
DFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKVTELEDKFDLLVDTNDVI
LERVGILLDEASGVNKHQQPVLPAGLQVPKTIVSSWNRKAGEYGKKAKSETFRLLHAKNI
IRPQLKFREKMDNSNTPFLPKIFVKPNAQKPLPQALSKERRECPQDRPEDLDVPPALADF
IHQQRTQQIEQDMFAHPYQYELDHFTPPASVLQKPQPQLHRPVEETPCHFVSSLDELVEL
NEKLLNCEEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIVDTLELRSDMYILNESLTNPA
IVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDYLLRLYCGVESNKQYQ
LADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLELWERGNEQPTQLQAVWQRSRDICLKK
FVKPIFTDESYLELYRKQKKHLNSQQLTAFQLLFSWRDKTARREDESFGYVLPNHMMLKI
AEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSETAAGVKKSGPLPGVE
RLENILFGPHDCSHAPPDGHPLTPTAGPVPARKQASLFTDPKEETQSLLATAVITLFNEP
SAEENGKTPLTVAQKKAQNIMESFENPFRMFLPSLEHRAHISQAAKFDPSSKIYEISNRW
KLASQVLVQKEAKEIAKKKVAEQTATREQAKEEYRATLEQAISVRQQAALENAAKKRERT
TSDPRTMEQKQEKKRLKISKKPKDPGPPEKDFTPYDYSQSNFKAFAGDSKPKPSSHFDPN
KQASAGKNCVAAKKLKQSVGNKSMSFPTGKSDRGFRHNWPKR
Download sequence
Identical sequences G5C519
HGL_H00000366135 XP_004863642.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]