SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366453 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366453
Domain Number 1 Region: 467-567
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-23
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 13-121
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-22
Family PDZ domain 0.0000203
Further Details:      
 
Domain Number 3 Region: 259-362
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-17
Family PDZ domain 0.048
Further Details:      
 
Domain Number 4 Region: 737-847
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000177
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 5 Region: 568-640
Classification Level Classification E-value
Superfamily SH3-domain 0.00000016
Family SH3-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366453
Sequence length 1151
Comment TJP2 (Homo_sapiens) tight junction protein 2 (zona occludens 2)
Sequence
MPVRGDRGFPPRRALSGWPRGPGMEELKWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENG
ETSIVISDVLPGGPADGLLKENDRVVMVNGTSMEGVLHSFAIQQLRKSGKVAAIVVKRPR
IVQGVPLQGSPALSHDDPAFDVMDEFDSRSVRSGYSERSRPGSREGLNRSWEGSPERGRG
YHRDQDHSRGQSLERGLNHEDRRARDCRRGQSVERYYEQDYERDYERAYYQAYGLDSPSG
SSRCRAQQERRYERPRNSSQEPRGQPDPDRHIGVLLMKNKASEEYGLRLGSQIFIKEMTK
TGLATKDGNLHEGDLILKINGTVTENMSLIDAGKLIEKSRGKLQLVVFRDSKQTLVNIPS
LNDSDSEIEDISEMGSVRSFSPEERRQQYSDYDYHSSSEKLKERPSSREDTAPGRLSRVG
ATPTPFKASGDTETKKEPRYQEEPPAPLPRAAPRAFLRPSPEDEAIYGPDTKMLRFKKGD
SVGLRLAGGNDVGLFVGGIQEGTAAEQAGLQEGDQILKVNTQDFRGMVREDAVLYLLEIP
KGEMVTILVQSRADVFRDILACGRGDSFFIRTHFECEKETPQSLPFTRGEVFRVVDTLYD
GKLGHWLAVRIGNELEKGLIPNKSRAEQMASVQNGQRDSAGDRADFWRMRGQRSGAKKNL
RKSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLTNELPDLFQTAK
TEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPESRQ
GIKMMRQRLNPSSNKSSRKLYDQANKLKKTCAYLFTATINLNSANDSWFGTLKDTIQNQQ
GQAVWVSEAKMEGMDDDPDDHMSYLTALGADYLSCDSRLISDFEDTDGEGGAYTDNELDE
PAEEPLVSSITRSSEPVQHEENIRKLSSDPPAQMRRAASRDQLRDSSPPPAFKPEPPKAK
TQSREESCDFSKSQEYKSNPSTMGGNEIPGTAGKGCPPPVAAKPSFGRSFQKPSISSPPP
ESEELRENSQEQEDTPKSVLGKVKIFEKMDHKARLQRMQELQEAQNAQIEIAQKHPSLYA
VPIKTPKPDAGLSQHTSSRPPEPQKGPSRPYQNMQGNYGSDAEEEEYRQQLAEHSKRSYY
SQPARYRDTEL
Download sequence
Identical sequences G5AVH8
HGL_H00000366453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]