SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366509-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366509-1
Domain Number 1 Region: 43-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.01e-34
Family SCAN domain 0.0000479
Further Details:      
 
Domain Number 2 Region: 226-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 337-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-16
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 188-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000385
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 272-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000342
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366509-1
Sequence length 401
Comment ZKSCAN4 (Homo_sapiens) zinc finger with KRAB and SCAN domains 4
Sequence
MAREPSEATALDARSAEDQMGLLVVKVEEEEASAGVEENNVPGPECARLCFCAFRYPEAA
GPQEALGRLRELCHQWLQPKTHSKEQILELLVLEQFLAVLPEELQAWLRTQHPGSGEEAA
ALLEFLEEQLEELPLQVEKTGGEMQAKIRGLSPAEEHPGQDPGRTPCHLGEDTAQDPACA
EAGKQEDRLQRKQKNAPASRRHVCYECGKSFAQSSGLTKHRRIHTGEKPYDCEDCGKTFI
GSSALRTHTGEKPYECEDCGKTFSQSCSLLEHHRIHTGEKPYQCTMCGKAFRRSSHLQRH
QRIHRDRNEQELWLGEASEGQARMESQWENVETPVSYKCNECERSFTQKIGLIEHQKIHT
GDKSYQCDACGKGFTRTSYFTQHQRSHVGKKNFCHSDSLYA
Download sequence
Identical sequences G5BSG8
HGL_H00000366509-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]